Zu "GeneID 6232" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
40S ribosomal protein S27 (RPS27), human, recombinant
Artikelnummer: CSB-EP020419HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-84aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: PLAKDLLHPS PEEEKRKHKK KRLVQSPNSY FMDVKCPGCY KITTVFSHAQ TVVLCVGCST VLCQPTGGKA RLTEGCSFRR KQH. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin:...
| Schlagworte: | MPS1, RPS27, MPS-1, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27, Recombinant... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 36.3 kD |
ab 283,00 €
Anti-RPS27
Artikelnummer: CSB-PA346286.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 163,00 €
Anti-RPS27
Artikelnummer: CSB-PA445027.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human
| Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 163,00 €
-30 %
Rabattaktion
Anti-MPS1 / RPS27, N-terminal
Artikelnummer: ARG63311.100
| Schlagworte: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Anwendung: | ELISA, WB |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
784,00 €
548,80 €
Anti-MPS1
Artikelnummer: NSJ-R35054-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27
| Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, MPS1 Antibody |
| Anwendung: | WB, ELISA (peptide), IHC (paraffin) |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
755,00 €
NEU
RPS27 (Vector Vector will be determined during the...
Artikelnummer: CSB-CL020419HU.10
Length: 255 Sequence: atgcctctcg caaaggatct ccttcatccc tctccagaag aggagaagag gaaacacaag aagaaacgcc tggtgcagag ccccaattcc tacttcatgg atgtgaaatg cccaggatgc tataaaatca ccacggtctt tagccatgca caaacggtag ttttgtgtgt tggctgctcc actgtcctct gccagcctac aggaggaaaa gcaaggctta cagaaggatg ttccttcagg aggaagcagc Protein function:...
| Schlagworte: | MPS1, RPS27, MPS-1, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
171,00 €
Anti-MPS1
Artikelnummer: 030453.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
| Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Anwendung: | ELISA, IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
682,00 €
Anti-MPS1
Artikelnummer: 030454.100
MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....
| Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27 |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
682,00 €
Anti-MPS1 / Metallopan-stimulin 1
Artikelnummer: NSJ-R32561
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 40S ribosomal protein S27, also known as Metallopan-stimulin 1 or MPS-1, is a protein that in humans is encoded by the RPS27 gene. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these...
| Schlagworte: | Anti-MPS1, Anti-MPS-1, Anti-RPS27, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Anwendung: | WB, IHC (paraffin), IF, ICC, FC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
755,00 €
RPS27, Recombinant, Human, aa1-84, GST-Tag (40S Ribosomal...
Artikelnummer: 375142.100
Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....
| Schlagworte: | MPS1, MPS-1, RPS27, Metallopan-stimulin 1, 40S ribosomal protein S27, Small ribosomal subunit protein eS27 |
| MW: | 36,3 |
ab 575,00 €
Anti-RPS27
Artikelnummer: G-CAB6729.20
Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]
| Schlagworte: | Anti-MPS1, Anti-RPS27, Anti-MPS-1, Anti-Metallopan-stimulin 1, Anti-40S ribosomal protein S27, Anti-Small ribosomal... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
149,00 €